Lineage for d1ww7b_ (1ww7 B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1308833Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1308834Protein automated matches [190437] (23 species)
    not a true protein
  7. 1308860Species Agrocybe cylindracea [TaxId:64608] [225007] (6 PDB entries)
  8. 1308866Domain d1ww7b_: 1ww7 B: [203046]
    automated match to d2r0hb_
    complexed with so4

Details for d1ww7b_

PDB Entry: 1ww7 (more details), 1.9 Å

PDB Description: Agrocybe cylindracea galectin (Ligand-free)
PDB Compounds: (B:) galectin

SCOPe Domain Sequences for d1ww7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ww7b_ b.29.1.0 (B:) automated matches {Agrocybe cylindracea [TaxId: 64608]}
ttsavniynisagasvdlaapvttgdivtffssalnlsagagspnntalnllsengayll
hiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinek
tviqytkqisgttsslsynstegtsifstvveavtytgla

SCOPe Domain Coordinates for d1ww7b_:

Click to download the PDB-style file with coordinates for d1ww7b_.
(The format of our PDB-style files is described here.)

Timeline for d1ww7b_: