Class b: All beta proteins [48724] (177 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
Protein automated matches [190437] (53 species) not a true protein |
Species Agrocybe cylindracea [TaxId:64608] [225007] (7 PDB entries) |
Domain d1ww7a_: 1ww7 A: [203045] automated match to d2r0hb_ complexed with so4 |
PDB Entry: 1ww7 (more details), 1.9 Å
SCOPe Domain Sequences for d1ww7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ww7a_ b.29.1.0 (A:) automated matches {Agrocybe cylindracea [TaxId: 64608]} ttsavniynisagasvdlaapvttgdivtffssalnlsagagspnntalnllsengayll hiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinek tviqytkqisgttsslsynstegtsifstvveavtytgla
Timeline for d1ww7a_: