SCOPe 2.07: Domain d1ww6c_: 1ww6 C:

Lineage for d1ww6c_ (1ww6 C:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (66 species)
   not a true protein

7. Species Agrocybe cylindracea [TaxId:64608] [225007] (7 PDB entries)

8. Domain d1ww6c_: 1ww6 C: [203043]
   automated match to d2r0hb_

Details for d1ww6c_

PDB Entry: 1ww6, 2.2 Å

PDB Description: agrocybe cylindracea galectin complexed with lactose

PDB Compounds: (C:) galectin

SCOPe Domain Sequences for d1ww6c_:

Sequence; same for both SEQRES and ATOM records:

>d1ww6c_ b.29.1.0 (C:) automated matches {Agrocybe cylindracea [TaxId: 64608]}
ttsavniynisagasvdlaapvttgdivtffssalnlsagagspnntalnllsengayll
hiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinek
tviqytkqisgttsslsynstegtsifstvveavtytgla

Timeline for d1ww6c_:

• d1ww6c_ first appeared in SCOPe 2.03
  
• d1ww6c_ appears in SCOPe 2.06
  
• d1ww6c_ appears in the current release, SCOPe 2.08