![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
![]() | Protein automated matches [190437] (70 species) not a true protein |
![]() | Species Agrocybe cylindracea [TaxId:64608] [225007] (7 PDB entries) |
![]() | Domain d1ww6c_: 1ww6 C: [203043] automated match to d2r0hb_ |
PDB Entry: 1ww6 (more details), 2.2 Å
SCOPe Domain Sequences for d1ww6c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ww6c_ b.29.1.0 (C:) automated matches {Agrocybe cylindracea [TaxId: 64608]} ttsavniynisagasvdlaapvttgdivtffssalnlsagagspnntalnllsengayll hiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinek tviqytkqisgttsslsynstegtsifstvveavtytgla
Timeline for d1ww6c_: