SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1ww5a_ (1ww5 A:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2044115Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2044116Protein automated matches [190437] (50 species)
    not a true protein
  7. 2044157Species Agrocybe cylindracea [TaxId:64608] [225007] (6 PDB entries)
  8. 2044166Domain d1ww5a_: 1ww5 A: [203037]
    automated match to d2r0hb_

Details for d1ww5a_

PDB Entry: 1ww5 (more details), 2.2 Å

PDB Description: Agrocybe cylindracea galectin complexed with 3'-sulfonyl lactose
PDB Compounds: (A:) galectin

SCOPe Domain Sequences for d1ww5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ww5a_ b.29.1.0 (A:) automated matches {Agrocybe cylindracea [TaxId: 64608]}
ttsavniynisagasvdlaapvttgdivtffssalnlsagagspnntalnllsengayll
hiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinek
tviqytkqisgttsslsynstegtsifstvveavtytgla

SCOPe Domain Coordinates for d1ww5a_:

Click to download the PDB-style file with coordinates for d1ww5a_.
(The format of our PDB-style files is described here.)

Timeline for d1ww5a_: