SCOPe 2.05: Domain d1wvwa_: 1wvw A:

Lineage for d1wvwa_ (1wvw A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein automated matches [190091] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188447] (553 PDB entries)

8. Domain d1wvwa_: 1wvw A: [203030]
   automated match to d2y4pc_

Details for d1wvwa_

PDB Entry: 1wvw, 2.4 Å

PDB Description: Crystal structures of kinase domain of DAP kinase in complex with small molecular inhibitors

PDB Compounds: (A:) Death-associated protein kinase 1

SCOPe Domain Sequences for d1wvwa_:

Sequence; same for both SEQRES and ATOM records:

>d1wvwa_ d.144.1.7 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
sntsalakdfirrllvkdpkkrmtiqdslqhpwik

Timeline for d1wvwa_:

• d1wvwa_ first appeared in SCOPe 2.03
  
• d1wvwa_ appears in SCOPe 2.04
  
• d1wvwa_ appears in SCOPe 2.06
  
• d1wvwa_ appears in the current release, SCOPe 2.08