Lineage for d1a5fh1 (1a5f H:1-120)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102051Species Anti-E-selectin Fab (mouse), kappa L chain [48864] (1 PDB entry)
  8. 102052Domain d1a5fh1: 1a5f H:1-120 [20303]
    Other proteins in same PDB: d1a5fh2, d1a5fl2

Details for d1a5fh1

PDB Entry: 1a5f (more details), 2.8 Å

PDB Description: fab fragment of a monoclonal anti-e-selectin antibody

SCOP Domain Sequences for d1a5fh1:

Sequence, based on SEQRES records: (download)

>d1a5fh1 b.1.1.1 (H:1-120) Immunoglobulin (variable domains of L and H chains) {Anti-E-selectin Fab (mouse), kappa L chain}
evalqqsgaelvkpgasvklscaasgftikdaymhwvkqkpeqglewigridsgssntny
dptfkgkatitaddssntaylqmssltsedtavyycarvglsywyamdywgqgtsvtvss

Sequence, based on observed residues (ATOM records): (download)

>d1a5fh1 b.1.1.1 (H:1-120) Immunoglobulin (variable domains of L and H chains) {Anti-E-selectin Fab (mouse), kappa L chain}
evalqqsgaelvkpgasvklscaasgftikdaymhwvkqkpeqglewigridsgssntny
dptfkgkatitaddssntaylqmssltsedtavyycarvyamdywgqgtsvtvss

SCOP Domain Coordinates for d1a5fh1:

Click to download the PDB-style file with coordinates for d1a5fh1.
(The format of our PDB-style files is described here.)

Timeline for d1a5fh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a5fh2