Lineage for d1wvtb_ (1wvt B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1266228Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) (S)
    crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site
  5. 1266247Family a.25.2.0: automated matches [191442] (1 protein)
    not a true family
  6. 1266248Protein automated matches [190652] (6 species)
    not a true protein
  7. 1266280Species Sulfolobus tokodaii [TaxId:273063] [225025] (2 PDB entries)
  8. 1266283Domain d1wvtb_: 1wvt B: [203028]
    automated match to d1noga_

Details for d1wvtb_

PDB Entry: 1wvt (more details), 2.3 Å

PDB Description: Crystal structure of uncharacterized protein ST2180 from Sulfolobus tokodaii
PDB Compounds: (B:) hypothetical protein ST2180

SCOPe Domain Sequences for d1wvtb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wvtb_ a.25.2.0 (B:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
dseivkalgdldelnsvlgvvsslypelseviqklqndifsisseiagfdmnfsdekvkg
ieelitnyskeleplrnfvlpgghiassflhlaravcrraersvvtllkeskakevhaky
lnrlssllfvlalvvnkrtnnpnviwr

SCOPe Domain Coordinates for d1wvtb_:

Click to download the PDB-style file with coordinates for d1wvtb_.
(The format of our PDB-style files is described here.)

Timeline for d1wvtb_: