Lineage for d1wvta_ (1wvt A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2705262Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) (S)
    crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site
  5. 2705281Family a.25.2.0: automated matches [191442] (1 protein)
    not a true family
  6. 2705282Protein automated matches [190652] (6 species)
    not a true protein
  7. 2705327Species Sulfolobus tokodaii [TaxId:273063] [225025] (2 PDB entries)
  8. 2705329Domain d1wvta_: 1wvt A: [203027]
    automated match to d1noga_

Details for d1wvta_

PDB Entry: 1wvt (more details), 2.3 Å

PDB Description: Crystal structure of uncharacterized protein ST2180 from Sulfolobus tokodaii
PDB Compounds: (A:) hypothetical protein ST2180

SCOPe Domain Sequences for d1wvta_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wvta_ a.25.2.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
kdseivkalgdldelnsvlgvvsslypelseviqklqndifsisseiagfdmnfsdekvk
gieelitnyskeleplrnfvlpgghiassflhlaravcrraersvvtllkeskakevhak
ylnrlssllfvlalvvnkrtnnpnviwr

SCOPe Domain Coordinates for d1wvta_:

Click to download the PDB-style file with coordinates for d1wvta_.
(The format of our PDB-style files is described here.)

Timeline for d1wvta_: