Class g: Small proteins [56992] (90 folds) |
Fold g.19: Crisp domain-like [57545] (1 superfamily) disulfide-rich all-alpha fold |
Superfamily g.19.1: Crisp domain-like [57546] (3 families) |
Family g.19.1.0: automated matches [227153] (1 protein) not a true family |
Protein automated matches [226858] (4 species) not a true protein |
Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [224989] (1 PDB entry) |
Domain d1wvra2: 1wvr A:165-221 [203026] Other proteins in same PDB: d1wvra1 automated match to d1rc9a2 complexed with cd |
PDB Entry: 1wvr (more details), 2.4 Å
SCOPe Domain Sequences for d1wvra2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wvra2 g.19.1.0 (A:165-221) automated matches {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]} ppcgdcpsdcdnglctnpctreneftncdslvqksscqdnymkskcpascfcqnkii
Timeline for d1wvra2: