SCOPe 2.08: Domain d1wvra2: 1wvr A:165-221

Lineage for d1wvra2 (1wvr A:165-221)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.19: Crisp domain-like [57545] (1 superfamily)
   disulfide-rich all-alpha fold

4. Superfamily g.19.1: Crisp domain-like [57546] (3 families)

5. Family g.19.1.0: automated matches [227153] (1 protein)
   not a true family

6. Protein automated matches [226858] (5 species)
   not a true protein

7. Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [224989] (1 PDB entry)

8. Domain d1wvra2: 1wvr A:165-221 [203026]
   Other proteins in same PDB: d1wvra1
   automated match to d1rc9a2
   complexed with cd

Details for d1wvra2

PDB Entry: 1wvr, 2.4 Å

PDB Description: crystal structure of a crisp family ca-channel blocker derived from snake venom

PDB Compounds: (A:) Triflin

SCOPe Domain Sequences for d1wvra2:

Sequence; same for both SEQRES and ATOM records:

>d1wvra2 g.19.1.0 (A:165-221) automated matches {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]}
ppcgdcpsdcdnglctnpctreneftncdslvqksscqdnymkskcpascfcqnkii

Timeline for d1wvra2:

• d1wvra2 first appeared in SCOPe 2.03
  
• d1wvra2 appears in SCOPe 2.07