Lineage for d1wvra1 (1wvr A:1-164)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1923144Fold d.111: PR-1-like [55796] (1 superfamily)
    alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342
  4. 1923145Superfamily d.111.1: PR-1-like [55797] (2 families) (S)
  5. 1923146Family d.111.1.1: PR-1-like [55798] (5 proteins)
    Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1
  6. 1923159Protein automated matches [194852] (3 species)
    not a true protein
  7. 1923170Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [224988] (1 PDB entry)
  8. 1923171Domain d1wvra1: 1wvr A:1-164 [203025]
    Other proteins in same PDB: d1wvra2
    automated match to d1rc9a1
    complexed with cd

Details for d1wvra1

PDB Entry: 1wvr (more details), 2.4 Å

PDB Description: crystal structure of a crisp family ca-channel blocker derived from snake venom
PDB Compounds: (A:) Triflin

SCOPe Domain Sequences for d1wvra1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wvra1 d.111.1.1 (A:1-164) automated matches {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]}
nvdfdsesprkpeiqneiidlhnslrrsvnptasnmlkmewypeaaanaerwayrciesh
ssrdsrviggikcgeniymatypakwtdiihawhgeykdfkygvgavpsdavighytqiv
wyksyragcaaaycpsskysyfyvcqycpagniigktatpyksg

SCOPe Domain Coordinates for d1wvra1:

Click to download the PDB-style file with coordinates for d1wvra1.
(The format of our PDB-style files is described here.)

Timeline for d1wvra1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wvra2