![]() | Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
![]() | Fold d.111: PR-1-like [55796] (1 superfamily) alpha-beta-alpha-beta-alpha(2)-beta(2); 3 layers, alpha/beta/alpha; mixed sheet: order 1342 |
![]() | Superfamily d.111.1: PR-1-like [55797] (2 families) ![]() |
![]() | Family d.111.1.1: PR-1-like [55798] (5 proteins) Pfam PF00188; groups mammalian SCP/TPX1; insects AG3/AG5; fungi SC7/SC14 and plant PR-1 |
![]() | Protein automated matches [194852] (3 species) not a true protein |
![]() | Species Habu snake (Trimeresurus flavoviridis) [TaxId:88087] [224988] (1 PDB entry) |
![]() | Domain d1wvra1: 1wvr A:1-164 [203025] Other proteins in same PDB: d1wvra2 automated match to d1rc9a1 complexed with cd |
PDB Entry: 1wvr (more details), 2.4 Å
SCOPe Domain Sequences for d1wvra1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wvra1 d.111.1.1 (A:1-164) automated matches {Habu snake (Trimeresurus flavoviridis) [TaxId: 88087]} nvdfdsesprkpeiqneiidlhnslrrsvnptasnmlkmewypeaaanaerwayrciesh ssrdsrviggikcgeniymatypakwtdiihawhgeykdfkygvgavpsdavighytqiv wyksyragcaaaycpsskysyfyvcqycpagniigktatpyksg
Timeline for d1wvra1: