Lineage for d1wtjb_ (1wtj B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922103Fold c.122: L-sulfolactate dehydrogenase-like [89732] (1 superfamily)
    core: 3 layers, a/b/a; mixed sheet of 7 strands, order 1237456; strands 1, 6 and 7 are antiparallel to the rest
  4. 2922104Superfamily c.122.1: L-sulfolactate dehydrogenase-like [89733] (2 families) (S)
    topological similarity to the domain 2 of TM1585
    automatically mapped to Pfam PF02615
  5. 2922156Family c.122.1.0: automated matches [227150] (1 protein)
    not a true family
  6. 2922157Protein automated matches [226854] (8 species)
    not a true protein
  7. 2922168Species Pseudomonas syringae [TaxId:323] [225024] (3 PDB entries)
  8. 2922170Domain d1wtjb_: 1wtj B: [203024]
    automated match to d1s20g_

Details for d1wtjb_

PDB Entry: 1wtj (more details), 1.55 Å

PDB Description: Crystal Structure of delta1-piperideine-2-carboxylate reductase from Pseudomonas syringae pvar.tomato
PDB Compounds: (B:) Ureidoglycolate Dehydrogenase

SCOPe Domain Sequences for d1wtjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wtjb_ c.122.1.0 (B:) automated matches {Pseudomonas syringae [TaxId: 323]}
dqptqtvsypqlidllrrifvvhgtspevadvlaencasaqrdgshshgifripgylssl
asgwvdgkavpvvedvgaafvrvdacngfaqpalaaarsllidkarsagvailairgshh
faalwpdvepfaeqglvalsmvnsmtcvvphgarqplfgtnpiafgapraggepivfdla
tsaiahgdvqiaaregrllpagmgvdrdglptqepraildggallpfgghkgsalsmmve
llaagltggnfsfefdwskhpgaqtpwtgqllividpdkgagqhfaqrseelvrqlhgvg
qerlpgdrrylerarsmahgiviaqadlerlqelagh

SCOPe Domain Coordinates for d1wtjb_:

Click to download the PDB-style file with coordinates for d1wtjb_.
(The format of our PDB-style files is described here.)

Timeline for d1wtjb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wtja_