SCOPe 2.06: Domain d1wtja_: 1wtj A:

Lineage for d1wtja_ (1wtj A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.122: L-sulfolactate dehydrogenase-like [89732] (1 superfamily)
   core: 3 layers, a/b/a; mixed sheet of 7 strands, order 1237456; strands 1, 6 and 7 are antiparallel to the rest

4. Superfamily c.122.1: L-sulfolactate dehydrogenase-like [89733] (2 families)
   topological similarity to the domain 2 of TM1585
   automatically mapped to Pfam PF02615

5. Family c.122.1.0: automated matches [227150] (1 protein)
   not a true family

6. Protein automated matches [226854] (5 species)
   not a true protein

7. Species Pseudomonas syringae [TaxId:323] [225024] (3 PDB entries)

8. Domain d1wtja_: 1wtj A: [203023]
   automated match to d1s20g_

Details for d1wtja_

PDB Entry: 1wtj, 1.55 Å

PDB Description: Crystal Structure of delta1-piperideine-2-carboxylate reductase from Pseudomonas syringae pvar.tomato

PDB Compounds: (A:) Ureidoglycolate Dehydrogenase

SCOPe Domain Sequences for d1wtja_:

Sequence; same for both SEQRES and ATOM records:

>d1wtja_ c.122.1.0 (A:) automated matches {Pseudomonas syringae [TaxId: 323]}
tqtvsypqlidllrrifvvhgtspevadvlaencasaqrdgshshgifripgylsslasg
wvdgkavpvvedvgaafvrvdacngfaqpalaaarsllidkarsagvailairgshhfaa
lwpdvepfaeqglvalsmvnsmtcvvphgarqplfgtnpiafgapraggepivfdlatsa
iahgdvqiaaregrllpagmgvdrdglptqepraildggallpfgghkgsalsmmvella
agltggnfsfefdwskhpgaqtpwtgqllividpdkgagqhfaqrseelvrqlhgvgqer
lpgdrrylerarsmahgiviaqadlerlqela

Timeline for d1wtja_:

• d1wtja_ first appeared in SCOPe 2.03
  
• d1wtja_ appears in SCOPe 2.05
  
• d1wtja_ appears in SCOPe 2.07
  
• d1wtja_ appears in the current release, SCOPe 2.08