Lineage for d1ws1a_ (1ws1 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3000942Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 3000943Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 3001128Family d.167.1.0: automated matches [191587] (1 protein)
    not a true family
  6. 3001129Protein automated matches [191055] (20 species)
    not a true protein
  7. 3001145Species Bacillus cereus [TaxId:1396] [225021] (2 PDB entries)
  8. 3001147Domain d1ws1a_: 1ws1 A: [203018]
    automated match to d2defa_
    complexed with bb2, ni

Details for d1ws1a_

PDB Entry: 1ws1 (more details), 2 Å

PDB Description: Structure analysis of peptide deformylase from Bacillus cereus
PDB Compounds: (A:) Peptide deformylase 1

SCOPe Domain Sequences for d1ws1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ws1a_ d.167.1.0 (A:) automated matches {Bacillus cereus [TaxId: 1396]}
mavleiikhpnevletpcervinfdkklvkllkdmhetmliadgvglaapqvgvslqvav
vdvdddtgkielinpsilekrgeqvgpegclsfpglygeveradyikvraqnrrgkvfll
eaegflaraiqheidhlhgvlftskvtryye

SCOPe Domain Coordinates for d1ws1a_:

Click to download the PDB-style file with coordinates for d1ws1a_.
(The format of our PDB-style files is described here.)

Timeline for d1ws1a_: