| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.167: Peptide deformylase [56419] (1 superfamily) alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix |
Superfamily d.167.1: Peptide deformylase [56420] (2 families) ![]() nickel-dependent enzyme |
| Family d.167.1.0: automated matches [191587] (1 protein) not a true family |
| Protein automated matches [191055] (20 species) not a true protein |
| Species Bacillus cereus [TaxId:1396] [225021] (2 PDB entries) |
| Domain d1ws0a_: 1ws0 A: [203017] automated match to d2defa_ complexed with ni |
PDB Entry: 1ws0 (more details), 1.7 Å
SCOPe Domain Sequences for d1ws0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ws0a_ d.167.1.0 (A:) automated matches {Bacillus cereus [TaxId: 1396]}
mavleiikhpnevletpcervinfdkklvkllkdmhetmliadgvglaapqvgvslqvav
vdvdddtgkielinpsilekrgeqvgpegclsfpglygeveradyikvraqnrrgkvfll
eaegflaraiqheidhlhgvlftskvtryye
Timeline for d1ws0a_: