Lineage for d1woza_ (1woz A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1992598Superfamily a.25.2: Cobalamin adenosyltransferase-like [89028] (3 families) (S)
    crossover loop goes across a different side of the 4-helical bundle; no internal metal-binding site
  5. 1992617Family a.25.2.0: automated matches [191442] (1 protein)
    not a true family
  6. 1992618Protein automated matches [190652] (6 species)
    not a true protein
  7. 1992651Species Sulfolobus tokodaii [TaxId:273063] [225025] (2 PDB entries)
  8. 1992652Domain d1woza_: 1woz A: [203012]
    automated match to d1rtyb_
    complexed with pog

Details for d1woza_

PDB Entry: 1woz (more details), 1.94 Å

PDB Description: Crystal structure of uncharacterized protein ST1454 from Sulfolobus tokodaii
PDB Compounds: (A:) 177aa long conserved hypothetical protein (ST1454)

SCOPe Domain Sequences for d1woza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1woza_ a.25.2.0 (A:) automated matches {Sulfolobus tokodaii [TaxId: 273063]}
gkdsplvnflgdldelnsfigfaiskipwedmkkdlervqvelfeigedlstqsskkkid
ekyvkwleertveyrkesgpvklfvipggseeasvlhvtrsvarrvernavkytkelpei
nrmiivylnrlssllfamalvankrrnvsekiydigkfw

SCOPe Domain Coordinates for d1woza_:

Click to download the PDB-style file with coordinates for d1woza_.
(The format of our PDB-style files is described here.)

Timeline for d1woza_: