Lineage for d1wnza_ (1wnz A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2412055Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
    core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel
  4. 2412056Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) (S)
  5. 2412057Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (4 proteins)
    inserted into the catalytic domain
  6. 2412086Protein automated matches [226874] (1 species)
    not a true protein
  7. 2412087Species Thermus thermophilus [TaxId:274] [225032] (4 PDB entries)
  8. 2412092Domain d1wnza_: 1wnz A: [203011]
    automated match to d1ue0a_
    protein/RNA complex; complexed with 2va

Details for d1wnza_

PDB Entry: 1wnz (more details), 1.7 Å

PDB Description: Isoleucyl-tRNA synthetase editing domain complexed with the post-transfer editing substrate analogue, Val-2AA
PDB Compounds: (A:) isoleucyl-tRNA synthetase

SCOPe Domain Sequences for d1wnza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wnza_ b.51.1.1 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
dpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdealile
eglgrkllgegtpvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgivhqa
pafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgllfkees

SCOPe Domain Coordinates for d1wnza_:

Click to download the PDB-style file with coordinates for d1wnza_.
(The format of our PDB-style files is described here.)

Timeline for d1wnza_: