![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily) core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel |
![]() | Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) ![]() |
![]() | Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (4 proteins) inserted into the catalytic domain |
![]() | Protein automated matches [226874] (1 species) not a true protein |
![]() | Species Thermus thermophilus [TaxId:274] [225032] (4 PDB entries) |
![]() | Domain d1wnza_: 1wnz A: [203011] automated match to d1ue0a_ protein/RNA complex; complexed with 2va |
PDB Entry: 1wnz (more details), 1.7 Å
SCOPe Domain Sequences for d1wnza_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wnza_ b.51.1.1 (A:) automated matches {Thermus thermophilus [TaxId: 274]} dpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdealile eglgrkllgegtpvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgivhqa pafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgllfkees
Timeline for d1wnza_: