Lineage for d1wnyb_ (1wny B:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1322965Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
    core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel
  4. 1322966Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family) (S)
  5. 1322967Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (4 proteins)
    inserted into the catalytic domain
  6. 1322998Protein automated matches [226874] (1 species)
    not a true protein
  7. 1322999Species Thermus thermophilus [TaxId:274] [225032] (2 PDB entries)
  8. 1323001Domain d1wnyb_: 1wny B: [203010]
    automated match to d1ue0a_

Details for d1wnyb_

PDB Entry: 1wny (more details), 1.6 Å

PDB Description: Isoleucyl-tRNA synthetase editing domain
PDB Compounds: (B:) isoleucyl-tRNA synthetase

SCOPe Domain Sequences for d1wnyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wnyb_ b.51.1.1 (B:) automated matches {Thermus thermophilus [TaxId: 274]}
dpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdealile
eglgrkllgegtpvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgivhqa
pafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgllfkees

SCOPe Domain Coordinates for d1wnyb_:

Click to download the PDB-style file with coordinates for d1wnyb_.
(The format of our PDB-style files is described here.)

Timeline for d1wnyb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wnya_