SCOP 1.59: Domain d15c8h1: 15c8 H:1-113

Lineage for d15c8h1 (15c8 H:1-113)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)

7. Species Catalytic Fab 5C8 (mouse), kappa L chain [48863] (3 PDB entries)

8. Domain d15c8h1: 15c8 H:1-113 [20301]
   Other proteins in same PDB: d15c8h2, d15c8l2

Details for d15c8h1

PDB Entry: 15c8, 2.5 Å

PDB Description: catalytic antibody 5c8, free fab

SCOP Domain Sequences for d15c8h1:

Sequence; same for both SEQRES and ATOM records:

>d15c8h1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Catalytic Fab 5C8 (mouse), kappa L chain}
evqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqkpeqglewiaqidpangntky
dpkfqgkatitadtssntaylhlssltsedsavyycaadppyyghgdywgqgttltvss

Timeline for d15c8h1:

• d15c8h1 first appeared (with stable ids) in SCOP 1.55
  
• d15c8h1 appears in SCOP 1.57
  
• d15c8h1 appears in SCOP 1.61
  
• d15c8h1 appears in the current release, SCOPe 2.08