Lineage for d15c8h1 (15c8 H:1-113)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 51642Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 51698Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)
  7. 51954Species Catalytic Fab 5C8 (mouse), kappa L chain [48863] (3 PDB entries)
  8. 51959Domain d15c8h1: 15c8 H:1-113 [20301]
    Other proteins in same PDB: d15c8h2, d15c8l2

Details for d15c8h1

PDB Entry: 15c8 (more details), 2.5 Å

PDB Description: catalytic antibody 5c8, free fab

SCOP Domain Sequences for d15c8h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d15c8h1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Catalytic Fab 5C8 (mouse), kappa L chain}
evqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqkpeqglewiaqidpangntky
dpkfqgkatitadtssntaylhlssltsedsavyycaadppyyghgdywgqgttltvss

SCOP Domain Coordinates for d15c8h1:

Click to download the PDB-style file with coordinates for d15c8h1.
(The format of our PDB-style files is described here.)

Timeline for d15c8h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d15c8h2