SCOPe 2.03: Domain d1wnya_: 1wny A:

Lineage for d1wnya_ (1wny A:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.51: ValRS/IleRS/LeuRS editing domain [50676] (1 superfamily)
   core: barrel, closed; n=6, S=8; topology is similar to that of the acid proteases barrel

4. Superfamily b.51.1: ValRS/IleRS/LeuRS editing domain [50677] (1 family)

5. Family b.51.1.1: ValRS/IleRS/LeuRS editing domain [50678] (4 proteins)
   inserted into the catalytic domain

6. Protein automated matches [226874] (1 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [225032] (2 PDB entries)

8. Domain d1wnya_: 1wny A: [203009]
   automated match to d1ue0a_

Details for d1wnya_

PDB Entry: 1wny, 1.6 Å

PDB Description: Isoleucyl-tRNA synthetase editing domain

PDB Compounds: (A:) isoleucyl-tRNA synthetase

SCOPe Domain Sequences for d1wnya_:

Sequence; same for both SEQRES and ATOM records:

>d1wnya_ b.51.1.1 (A:) automated matches {Thermus thermophilus [TaxId: 274]}
dpsvyvrfplkepkklglekaslliwtttpwtlpgnvaaavhpeytyaafqvgdealile
eglgrkllgegtpvlktfpgkaleglpytppypqalekgyfvvladyvsqedgtgivhqa
pafgaedletarvyglpllktvdeegkllvepfkglyfreanrailrdlrgrgllfkees

Timeline for d1wnya_:

• d1wnya_ is new in SCOPe 2.03-stable
  
• d1wnya_ appears in SCOPe 2.04
  
• d1wnya_ appears in the current release, SCOPe 2.08