Lineage for d1wnfb_ (1wnf B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142620Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
    consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
    Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
    Domain 2 has parallel beta-sheet of 4 strands, order 1234
  4. 2142621Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) (S)
  5. 2142766Family c.88.1.0: automated matches [191606] (1 protein)
    not a true family
  6. 2142767Protein automated matches [191105] (4 species)
    not a true protein
  7. 2142773Species Pyrococcus horikoshii [TaxId:53953] [224960] (2 PDB entries)
  8. 2142777Domain d1wnfb_: 1wnf B: [203008]
    automated match to d3ntxa_
    complexed with edo

Details for d1wnfb_

PDB Entry: 1wnf (more details), 2.5 Å

PDB Description: Crystal Structure of PH0066 from Pyrococcus horikoshii
PDB Compounds: (B:) L-asparaginase

SCOPe Domain Sequences for d1wnfb_:

Sequence, based on SEQRES records: (download)

>d1wnfb_ c.88.1.0 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mrililgmggtiasvkgergyesalsvskilklagisseakieardlmnvdstliqpsdw
erlakeiekevweydgivithgtdtmaysasmlsfmlrnppipivltgsmlpiteknsda
pfnlrtalefvklgirgiyiafngkvmlgvraskirsmgfdafesinypnvaeikddklr
ilhipdfygdeffsdikyepkvlviklipglsgdivrealrlgykgiilegygvggipyr
gtdlfevvssiskripvvlttqaiydgvdlqrykvgrialeagvipagdmtkeatitklm
wilghtknieevkqlmgknitgeltr

Sequence, based on observed residues (ATOM records): (download)

>d1wnfb_ c.88.1.0 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mrililgmggtiasvkgergyesalsvskilklagisakieardlmnvdstliqpsdwer
lakeiekevweydgivithgtdtmaysasmlsfmlrnppipivltgsmlpiteknsdapf
nlrtalefvklgirgiyiafngkvmlgvraskirsmgfdafesinypnvaeikddklril
hipdfygdeffsdikyepkvlviklipglsgdivrealrlgykgiilegygvggipyrgt
dlfevvssiskripvvlttqaiydgvdlqrykvgrialeagvipagdmtkeatitklmwi
lghtknieevkqlmgknitgeltr

SCOPe Domain Coordinates for d1wnfb_:

Click to download the PDB-style file with coordinates for d1wnfb_.
(The format of our PDB-style files is described here.)

Timeline for d1wnfb_: