SCOPe 2.05: Domain d1wlsa_: 1wls A:

Lineage for d1wlsa_ (1wls A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
   consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
   Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
   Domain 2 has parallel beta-sheet of 4 strands, order 1234

4. Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families)

5. Family c.88.1.0: automated matches [191606] (1 protein)
   not a true family

6. Protein automated matches [191105] (3 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:53953] [224960] (2 PDB entries)

8. Domain d1wlsa_: 1wls A: [203005]
   automated match to d3ntxa_

Details for d1wlsa_

PDB Entry: 1wls, 2.16 Å

PDB Description: Crystal structure of L-asparaginase I homologue protein from Pyrococcus horikoshii

PDB Compounds: (A:) L-asparaginase

SCOPe Domain Sequences for d1wlsa_:

Sequence; same for both SEQRES and ATOM records:

>d1wlsa_ c.88.1.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mrililgmggtiasvkgergyesalsvskilklagisseakieardlmnvdstliqpsdw
erlakeiekevweydgivithgtdtmaysasmlsfmlrnppipivltgsmlpiteknsda
pfnlrtalefvklgirgiyiafngkvmlgvraskirsmgfdafesinypnvaeikddklr
ilhipdfygdeffsdikyepkvlviklipglsgdivrealrlgykgiilegygvggipyr
gtdlfevvssiskripvvlttqaiydgvdlqrykvgrialeagvipagdmtkeatitklm
wilghtknieevkqlmgknitgeltrvs

Timeline for d1wlsa_:

• d1wlsa_ first appeared in SCOPe 2.03
  
• d1wlsa_ appears in SCOPe 2.04
  
• d1wlsa_ appears in SCOPe 2.06
  
• d1wlsa_ appears in the current release, SCOPe 2.08