| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily) consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5 Domain 2 has parallel beta-sheet of 4 strands, order 1234 |
Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) ![]() |
| Family c.88.1.0: automated matches [191606] (1 protein) not a true family |
| Protein automated matches [191105] (6 species) not a true protein |
| Species Pyrococcus horikoshii [TaxId:53953] [224960] (2 PDB entries) |
| Domain d1wlsa_: 1wls A: [203005] automated match to d3ntxa_ |
PDB Entry: 1wls (more details), 2.16 Å
SCOPe Domain Sequences for d1wlsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wlsa_ c.88.1.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mrililgmggtiasvkgergyesalsvskilklagisseakieardlmnvdstliqpsdw
erlakeiekevweydgivithgtdtmaysasmlsfmlrnppipivltgsmlpiteknsda
pfnlrtalefvklgirgiyiafngkvmlgvraskirsmgfdafesinypnvaeikddklr
ilhipdfygdeffsdikyepkvlviklipglsgdivrealrlgykgiilegygvggipyr
gtdlfevvssiskripvvlttqaiydgvdlqrykvgrialeagvipagdmtkeatitklm
wilghtknieevkqlmgknitgeltrvs
Timeline for d1wlsa_: