Lineage for d1wlsa_ (1wls A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2911318Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
    consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
    Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
    Domain 2 has parallel beta-sheet of 4 strands, order 1234
  4. 2911319Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) (S)
  5. 2911690Family c.88.1.0: automated matches [191606] (1 protein)
    not a true family
  6. 2911691Protein automated matches [191105] (6 species)
    not a true protein
  7. 2911713Species Pyrococcus horikoshii [TaxId:53953] [224960] (2 PDB entries)
  8. 2911714Domain d1wlsa_: 1wls A: [203005]
    automated match to d3ntxa_

Details for d1wlsa_

PDB Entry: 1wls (more details), 2.16 Å

PDB Description: Crystal structure of L-asparaginase I homologue protein from Pyrococcus horikoshii
PDB Compounds: (A:) L-asparaginase

SCOPe Domain Sequences for d1wlsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wlsa_ c.88.1.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mrililgmggtiasvkgergyesalsvskilklagisseakieardlmnvdstliqpsdw
erlakeiekevweydgivithgtdtmaysasmlsfmlrnppipivltgsmlpiteknsda
pfnlrtalefvklgirgiyiafngkvmlgvraskirsmgfdafesinypnvaeikddklr
ilhipdfygdeffsdikyepkvlviklipglsgdivrealrlgykgiilegygvggipyr
gtdlfevvssiskripvvlttqaiydgvdlqrykvgrialeagvipagdmtkeatitklm
wilghtknieevkqlmgknitgeltrvs

SCOPe Domain Coordinates for d1wlsa_:

Click to download the PDB-style file with coordinates for d1wlsa_.
(The format of our PDB-style files is described here.)

Timeline for d1wlsa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1wlsb_