![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
![]() | Superfamily c.95.1: Thiolase-like [53901] (3 families) ![]() |
![]() | Family c.95.1.0: automated matches [196908] (1 protein) not a true family |
![]() | Protein automated matches [196909] (83 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [224964] (6 PDB entries) |
![]() | Domain d1wl5a1: 1wl5 A:4-271 [203003] automated match to d1afwa1 complexed with gol, so4 |
PDB Entry: 1wl5 (more details), 2.26 Å
SCOPe Domain Sequences for d1wl5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wl5a1 c.95.1.0 (A:4-271) automated matches {Human (Homo sapiens) [TaxId: 9606]} gsdpvvivsaartiigsfngalaavpvqdlgstvikevlkratvapedvsevifghvlaa gcgqnpvrqasvgagipysvpawscqmicgsglkavclavqsigigdssivvaggmenms kaphlaylrtgvkigempltdsilcdgltdafhnchmgitaenvakkwqvsredqdkvav lsqnrtenaqkaghfdkeivpvlvstrkglievktdefprhgsnieamsklkpyfltdgt gtvtpanasgindgaaavvlmkkseadk
Timeline for d1wl5a1: