Lineage for d1wl4a2 (1wl4 A:272-397)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2917323Family c.95.1.0: automated matches [196908] (1 protein)
    not a true family
  6. 2917324Protein automated matches [196909] (83 species)
    not a true protein
  7. 2917733Species Human (Homo sapiens) [TaxId:9606] [224964] (6 PDB entries)
  8. 2917735Domain d1wl4a2: 1wl4 A:272-397 [203002]
    automated match to d1afwa2
    complexed with coa, gol, so4

Details for d1wl4a2

PDB Entry: 1wl4 (more details), 1.55 Å

PDB Description: Human cytosolic acetoacetyl-CoA thiolase complexed with CoA
PDB Compounds: (A:) acetyl-Coenzyme A acetyltransferase 2

SCOPe Domain Sequences for d1wl4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wl4a2 c.95.1.0 (A:272-397) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rgltplarivswsqvgvepsimgigpipaikqavtkagwsledvdifeineafaavsaai
vkelglnpekvnieggaialghplgasgcrilvtllhtlermgrsrgvaalcigggmgia
mcvqre

SCOPe Domain Coordinates for d1wl4a2:

Click to download the PDB-style file with coordinates for d1wl4a2.
(The format of our PDB-style files is described here.)

Timeline for d1wl4a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wl4a1