Lineage for d1wkmb1 (1wkm B:1-194,B:272-295)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2974562Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 2974563Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) (S)
  5. 2974564Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins)
  6. 2974613Protein Methionine aminopeptidase [55924] (7 species)
  7. 2974684Species Pyrococcus furiosus [TaxId:2261] [55926] (5 PDB entries)
    contains insert domain with a circularly permuted "winged helix" fold
  8. 2974688Domain d1wkmb1: 1wkm B:1-194,B:272-295 [202995]
    Other proteins in same PDB: d1wkma2, d1wkmb2
    automated match to d1xgsa2
    complexed with met, mn

Details for d1wkmb1

PDB Entry: 1wkm (more details), 2.3 Å

PDB Description: the product bound form of the mn(ii)loaded methionine aminopeptidase from hyperthermophile pyrococcus furiosus
PDB Compounds: (B:) Methionine aminopeptidase

SCOPe Domain Sequences for d1wkmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wkmb1 d.127.1.1 (B:1-194,B:272-295) Methionine aminopeptidase {Pyrococcus furiosus [TaxId: 2261]}
mdteklmkageiakkvrekaiklarpgmlllelaesiekmimelggkpafpvnlsineia
ahytpykgdttvlkegdylkidvgvhidgfiadtavtvrvgmeedelmeaakealnaais
varagveikelgkaieneirkrgfkpivnlsghkieryklhagisipniyrphdnyvlke
gdvfaiepfatigaXrngivaqfehtiivekdsvivtte

SCOPe Domain Coordinates for d1wkmb1:

Click to download the PDB-style file with coordinates for d1wkmb1.
(The format of our PDB-style files is described here.)

Timeline for d1wkmb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wkmb2