Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily) duplication: composed of two very similar alpha+beta folds |
Superfamily d.127.1: Creatinase/aminopeptidase [55920] (2 families) |
Family d.127.1.1: Creatinase/aminopeptidase [55921] (4 proteins) |
Protein Methionine aminopeptidase [55924] (6 species) |
Species Pyrococcus furiosus [TaxId:2261] [55926] (5 PDB entries) contains insert domain with a circularly permuted "winged helix" fold |
Domain d1wkma1: 1wkm A:1-194,A:272-295 [202993] Other proteins in same PDB: d1wkma2, d1wkmb2 automated match to d1xgsa2 complexed with met, mn |
PDB Entry: 1wkm (more details), 2.3 Å
SCOPe Domain Sequences for d1wkma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wkma1 d.127.1.1 (A:1-194,A:272-295) Methionine aminopeptidase {Pyrococcus furiosus [TaxId: 2261]} mdteklmkageiakkvrekaiklarpgmlllelaesiekmimelggkpafpvnlsineia ahytpykgdttvlkegdylkidvgvhidgfiadtavtvrvgmeedelmeaakealnaais varagveikelgkaieneirkrgfkpivnlsghkieryklhagisipniyrphdnyvlke gdvfaiepfatigaXrngivaqfehtiivekdsvivtte
Timeline for d1wkma1: