Lineage for d25c8h1 (25c8 H:1-113)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 287095Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 287096Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 287097Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)
  6. 287195Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species
  7. 287384Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88551] (28 PDB entries)
  8. 287397Domain d25c8h1: 25c8 H:1-113 [20299]
    Other proteins in same PDB: d25c8h2, d25c8l1, d25c8l2
    part of catalytic Fab 5C8
    complexed with gep

Details for d25c8h1

PDB Entry: 25c8 (more details), 2 Å

PDB Description: catalytic antibody 5c8, fab-hapten complex

SCOP Domain Sequences for d25c8h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d25c8h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.1}
evqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqkpeqglewiaqidpangntky
dpkfqgkatitadtssntaylhlssltsedsavyycaadppyyghgdywgqgttltvss

SCOP Domain Coordinates for d25c8h1:

Click to download the PDB-style file with coordinates for d25c8h1.
(The format of our PDB-style files is described here.)

Timeline for d25c8h1:

View in 3D
Domains from same chain:
(mouse over for more information)
d25c8h2