SCOPe 2.08: Domain d1w52x2: 1w52 X:339-452

Lineage for d1w52x2 (1w52 X:339-452)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.12: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49722] (1 superfamily)
   sandwich; 8 strands in 2 sheets; complex topology
   duplication: has weak internal pseudo twofold symmetry

4. Superfamily b.12.1: Lipase/lipooxygenase domain (PLAT/LH2 domain) [49723] (4 families)

5. Family b.12.1.0: automated matches [227174] (1 protein)
   not a true family

6. Protein automated matches [226891] (5 species)
   not a true protein

7. Species Horse (Equus caballus) [TaxId:9796] [225096] (1 PDB entry)

8. Domain d1w52x2: 1w52 X:339-452 [202983]
   Other proteins in same PDB: d1w52x1
   automated match to d1bu8a1
   complexed with ca, ddq

Details for d1w52x2

PDB Entry: 1w52, 2.99 Å

PDB Description: crystal structure of a proteolyzed form of pancreatic lipase related protein 2 from horse

PDB Compounds: (X:) pancreatic lipase related protein 2

SCOPe Domain Sequences for d1w52x2:

Sequence; same for both SEQRES and ATOM records:

>d1w52x2 b.12.1.0 (X:339-452) automated matches {Horse (Equus caballus) [TaxId: 9796]}
swryrvsitlagsgkangylkvtlrgsngnskqyeifkgslqpdssytldvdvnfiigki
qevkfvwnktvlnlskpqlgasritvqsgadgteykfcgsgtvqdnveqslypc

Timeline for d1w52x2:

• d1w52x2 first appeared in SCOPe 2.03
  
• d1w52x2 appears in SCOPe 2.07