Lineage for d1w52x1 (1w52 X:1-338)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2135356Family c.69.1.19: Pancreatic lipase, N-terminal domain [53577] (2 protein domains)
    automatically mapped to Pfam PF00151
  6. 2135374Protein automated matches [226890] (2 species)
    not a true protein
  7. 2135375Species Horse (Equus caballus) [TaxId:9796] [225095] (1 PDB entry)
  8. 2135376Domain d1w52x1: 1w52 X:1-338 [202982]
    Other proteins in same PDB: d1w52x2
    automated match to d1bu8a2
    complexed with ca, ddq

Details for d1w52x1

PDB Entry: 1w52 (more details), 2.99 Å

PDB Description: crystal structure of a proteolyzed form of pancreatic lipase related protein 2 from horse
PDB Compounds: (X:) pancreatic lipase related protein 2

SCOPe Domain Sequences for d1w52x1:

Sequence, based on SEQRES records: (download)

>d1w52x1 c.69.1.19 (X:1-338) automated matches {Horse (Equus caballus) [TaxId: 9796]}
kevcytplgcfsddkpwagtlqrplkslpwspeevntrfllytnknpdsyqlitardvat
ikssnfqssrkthfvihgfrdrgedswpsdmckkilqvettncisvdwssgakaeytqav
qnirivgaetayliqqlltelsynpenvhiighslgahtageagrrlegrvgrvtgldpa
epcfqdaseevrldpsdaqfvdvihtdaspmlpslgfgmsqkvghmdffpnggkqmpgck
rssfstfidingiwqgaqdylacnhlksfeyysssilnpdgflaypcdsydkfqengcfp
cpaggcpkmghyadqykektsaveqtfflntgesgdyt

Sequence, based on observed residues (ATOM records): (download)

>d1w52x1 c.69.1.19 (X:1-338) automated matches {Horse (Equus caballus) [TaxId: 9796]}
kevcytplgcfsddkpwagtlqrplkslpwspeevntrfllytnknpdsyqlitardvat
ikssnfqssrkthfvihgfrdrgedswpsdmckkilqvettncisvdwssgakaeytqav
qnirivgaetayliqqlltelsynpenvhiighslgahtageagrrlegrvgrvtgldpa
epcfqdaseevrldpsdaqfvdvihtdaspmlpslgfgmsqkvghmdffpnggkqmpgck
rsfidingiwqgaqdylacnhlksfeyysssilnpdgflaypcdsydkfqengcfpcpag
gcpkmghyadqykektsaveqtfflntgesgdyt

SCOPe Domain Coordinates for d1w52x1:

Click to download the PDB-style file with coordinates for d1w52x1.
(The format of our PDB-style files is described here.)

Timeline for d1w52x1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w52x2