Lineage for d1w3sb2 (1w3s B:81-238)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1707036Fold g.45: ArfGap/RecO-like zinc finger [57862] (1 superfamily)
    zinc-bound alpha+beta motif
  4. 1707037Superfamily g.45.1: ArfGap/RecO-like zinc finger [57863] (3 families) (S)
  5. 1707042Family g.45.1.2: RecO C-terminal domain-like [118303] (1 protein)
    C-terminal part of Pfam PF02565
  6. 1707043Protein Recombinational repair protein RecO, C-terminal domain [118304] (1 species)
  7. 1707044Species Deinococcus radiodurans [TaxId:1299] [118305] (2 PDB entries)
    Uniprot Q9RW50 # DR0819
  8. 1707048Domain d1w3sb2: 1w3s B:81-238 [202981]
    Other proteins in same PDB: d1w3sa1, d1w3sb1
    automated match to d1u5ka2
    complexed with zn

Details for d1w3sb2

PDB Entry: 1w3s (more details), 2.4 Å

PDB Description: the crystal structure of reco from deinococcus radiodurans.
PDB Compounds: (B:) hypothetical protein dr0819

SCOPe Domain Sequences for d1w3sb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w3sb2 g.45.1.2 (B:81-238) Recombinational repair protein RecO, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]}
ptlaeperyafahlmaefadalfqegefseqafdlfaaslrgvahqpdpewvalvmsykl
lglagvipqtarcarcgapdpehpdplggqllcskcaalppyppavldflrhavrrtvra
sfeqpvpsadrpalwralekfvtvqvggvhswrqlvps

SCOPe Domain Coordinates for d1w3sb2:

Click to download the PDB-style file with coordinates for d1w3sb2.
(The format of our PDB-style files is described here.)

Timeline for d1w3sb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w3sb1