Class g: Small proteins [56992] (100 folds) |
Fold g.45: ArfGap/RecO-like zinc finger [57862] (1 superfamily) zinc-bound alpha+beta motif |
Superfamily g.45.1: ArfGap/RecO-like zinc finger [57863] (3 families) |
Family g.45.1.2: RecO C-terminal domain-like [118303] (1 protein) C-terminal part of Pfam PF02565 |
Protein Recombinational repair protein RecO, C-terminal domain [118304] (1 species) |
Species Deinococcus radiodurans [TaxId:1299] [118305] (2 PDB entries) Uniprot Q9RW50 # DR0819 |
Domain d1w3sb2: 1w3s B:81-238 [202981] Other proteins in same PDB: d1w3sa1, d1w3sb1 automated match to d1u5ka2 complexed with zn |
PDB Entry: 1w3s (more details), 2.4 Å
SCOPe Domain Sequences for d1w3sb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w3sb2 g.45.1.2 (B:81-238) Recombinational repair protein RecO, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]} ptlaeperyafahlmaefadalfqegefseqafdlfaaslrgvahqpdpewvalvmsykl lglagvipqtarcarcgapdpehpdplggqllcskcaalppyppavldflrhavrrtvra sfeqpvpsadrpalwralekfvtvqvggvhswrqlvps
Timeline for d1w3sb2: