![]() | Class b: All beta proteins [48724] (177 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
![]() | Family b.40.4.13: RecO N-terminal domain-like [117204] (1 protein) N-terminal part of Pfam PF02565 |
![]() | Protein Recombinational repair protein RecO, N-terminal domain [117205] (1 species) |
![]() | Species Deinococcus radiodurans [TaxId:1299] [117206] (2 PDB entries) Uniprot Q9RW50 # DR0819 |
![]() | Domain d1w3sb1: 1w3s B:3-80 [202980] Other proteins in same PDB: d1w3sa2, d1w3sb2 automated match to d1u5ka1 complexed with zn |
PDB Entry: 1w3s (more details), 2.4 Å
SCOPe Domain Sequences for d1w3sb1:
Sequence, based on SEQRES records: (download)
>d1w3sb1 b.40.4.13 (B:3-80) Recombinational repair protein RecO, N-terminal domain {Deinococcus radiodurans [TaxId: 1299]} srtanrsgivirrrvtpagdiivtlltpqgklkaiarggvkgplssslnlfhhvgvqvyq gphndlasvkqavlegal
>d1w3sb1 b.40.4.13 (B:3-80) Recombinational repair protein RecO, N-terminal domain {Deinococcus radiodurans [TaxId: 1299]} srtanrsgivirrrvtpagdiivtlltpqgklkaiarglssslnlfhhvgvqvyqgphnd lasvkqavlegal
Timeline for d1w3sb1: