Lineage for d25c8l1 (25c8 L:1-107)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 219340Species Catalytic Fab 5C8 (mouse), kappa L chain [48863] (3 PDB entries)
  8. 219344Domain d25c8l1: 25c8 L:1-107 [20298]
    Other proteins in same PDB: d25c8h2, d25c8l2

Details for d25c8l1

PDB Entry: 25c8 (more details), 2 Å

PDB Description: catalytic antibody 5c8, fab-hapten complex

SCOP Domain Sequences for d25c8l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d25c8l1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Catalytic Fab 5C8 (mouse), kappa L chain}
divltqspaimsaslgervtmtctasssvsssnlhwyqqkpgsspklwiystsnlasgvp
arfsgsgsgtsysltissmeaedaatyychqyhrspytfgggtkleik

SCOP Domain Coordinates for d25c8l1:

Click to download the PDB-style file with coordinates for d25c8l1.
(The format of our PDB-style files is described here.)

Timeline for d25c8l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d25c8l2