SCOPe 2.07: Domain d1w3sa2: 1w3s A:81-237

Lineage for d1w3sa2 (1w3s A:81-237)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.45: ArfGap/RecO-like zinc finger [57862] (1 superfamily)
   zinc-bound alpha+beta motif

4. Superfamily g.45.1: ArfGap/RecO-like zinc finger [57863] (3 families)

5. Family g.45.1.2: RecO C-terminal domain-like [118303] (1 protein)
   C-terminal part of Pfam PF02565

6. Protein Recombinational repair protein RecO, C-terminal domain [118304] (1 species)

7. Species Deinococcus radiodurans [TaxId:1299] [118305] (2 PDB entries)
   Uniprot Q9RW50 # DR0819

8. Domain d1w3sa2: 1w3s A:81-237 [202979]
   Other proteins in same PDB: d1w3sa1, d1w3sb1
   automated match to d1u5ka2
   complexed with zn

Details for d1w3sa2

PDB Entry: 1w3s, 2.4 Å

PDB Description: the crystal structure of reco from deinococcus radiodurans.

PDB Compounds: (A:) hypothetical protein dr0819

SCOPe Domain Sequences for d1w3sa2:

Sequence; same for both SEQRES and ATOM records:

>d1w3sa2 g.45.1.2 (A:81-237) Recombinational repair protein RecO, C-terminal domain {Deinococcus radiodurans [TaxId: 1299]}
ptlaeperyafahlmaefadalfqegefseqafdlfaaslrgvahqpdpewvalvmsykl
lglagvipqtarcarcgapdpehpdplggqllcskcaalppyppavldflrhavrrtvra
sfeqpvpsadrpalwralekfvtvqvggvhswrqlvp

Timeline for d1w3sa2:

• d1w3sa2 first appeared in SCOPe 2.03
  
• d1w3sa2 appears in SCOPe 2.06
  
• d1w3sa2 appears in the current release, SCOPe 2.08