Lineage for d1w3sa1 (1w3s A:2-80)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2787872Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2789270Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2790368Family b.40.4.13: RecO N-terminal domain-like [117204] (1 protein)
    N-terminal part of Pfam PF02565
  6. 2790369Protein Recombinational repair protein RecO, N-terminal domain [117205] (1 species)
  7. 2790370Species Deinococcus radiodurans [TaxId:1299] [117206] (2 PDB entries)
    Uniprot Q9RW50 # DR0819
  8. 2790373Domain d1w3sa1: 1w3s A:2-80 [202978]
    Other proteins in same PDB: d1w3sa2, d1w3sb2
    automated match to d1u5ka1
    complexed with zn

Details for d1w3sa1

PDB Entry: 1w3s (more details), 2.4 Å

PDB Description: the crystal structure of reco from deinococcus radiodurans.
PDB Compounds: (A:) hypothetical protein dr0819

SCOPe Domain Sequences for d1w3sa1:

Sequence, based on SEQRES records: (download)

>d1w3sa1 b.40.4.13 (A:2-80) Recombinational repair protein RecO, N-terminal domain {Deinococcus radiodurans [TaxId: 1299]}
rsrtanrsgivirrrvtpagdiivtlltpqgklkaiarggvkgplssslnlfhhvgvqvy
qgphndlasvkqavlegal

Sequence, based on observed residues (ATOM records): (download)

>d1w3sa1 b.40.4.13 (A:2-80) Recombinational repair protein RecO, N-terminal domain {Deinococcus radiodurans [TaxId: 1299]}
rsrtanrsgivirrrvtpagdiivtlltpqgklkaiargssslnlfhhvgvqvyqgphnd
lasvkqavlegal

SCOPe Domain Coordinates for d1w3sa1:

Click to download the PDB-style file with coordinates for d1w3sa1.
(The format of our PDB-style files is described here.)

Timeline for d1w3sa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1w3sa2