SCOPe 2.05: Domain d1w1yb3: 1w1y B:447-499

Lineage for d1w1yb3 (1w1y B:447-499)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.72: WW domain-like [51044] (3 superfamilies)
   core: 3-stranded meander beta-sheet

4. Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family)

5. Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins)

6. Protein Chitinase B, C-terminal domain [51061] (1 species)

7. Species Serratia marcescens [TaxId:615] [51062] (18 PDB entries)

8. Domain d1w1yb3: 1w1y B:447-499 [202977]
   Other proteins in same PDB: d1w1ya1, d1w1ya2, d1w1yb1, d1w1yb2
   automated match to d1o6ia1
   complexed with gol, so4, typ

Details for d1w1yb3

PDB Entry: 1w1y, 1.85 Å

PDB Description: crystal structure of s. marcescens chitinase b in complex with the cyclic dipeptide inhibitor cyclo-(l-tyr-l-pro) at 1.85 a resolution

PDB Compounds: (B:) chitinase b

SCOPe Domain Sequences for d1w1yb3:

Sequence; same for both SEQRES and ATOM records:

>d1w1yb3 b.72.2.1 (B:447-499) Chitinase B, C-terminal domain {Serratia marcescens [TaxId: 615]}
nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrva

Timeline for d1w1yb3:

• d1w1yb3 first appeared in SCOPe 2.03
  
• d1w1yb3 appears in SCOPe 2.04
  
• d1w1yb3 appears in SCOPe 2.06
  
• d1w1yb3 appears in the current release, SCOPe 2.08