Class b: All beta proteins [48724] (176 folds) |
Fold b.72: WW domain-like [51044] (3 superfamilies) core: 3-stranded meander beta-sheet |
Superfamily b.72.2: Carbohydrate binding domain [51055] (1 family) |
Family b.72.2.1: Carbohydrate binding domain [51056] (3 proteins) |
Protein Chitinase B, C-terminal domain [51061] (1 species) |
Species Serratia marcescens [TaxId:615] [51062] (18 PDB entries) |
Domain d1w1yb3: 1w1y B:447-499 [202977] Other proteins in same PDB: d1w1ya1, d1w1ya2, d1w1yb1, d1w1yb2 automated match to d1o6ia1 complexed with gol, so4, typ |
PDB Entry: 1w1y (more details), 1.85 Å
SCOPe Domain Sequences for d1w1yb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w1yb3 b.72.2.1 (B:447-499) Chitinase B, C-terminal domain {Serratia marcescens [TaxId: 615]} nlpimtapayvpgttyaqgalvsyqgyvwqtkwgyitsapgsdsawlkvgrva
Timeline for d1w1yb3: