![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) ![]() |
![]() | Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
![]() | Protein Chitinase B [54560] (1 species) |
![]() | Species Serratia marcescens [TaxId:615] [54561] (18 PDB entries) |
![]() | Domain d1w1yb2: 1w1y B:292-379 [202976] Other proteins in same PDB: d1w1ya1, d1w1ya3, d1w1yb1, d1w1yb3 automated match to d1o6ia3 complexed with gol, so4, typ |
PDB Entry: 1w1y (more details), 1.85 Å
SCOPe Domain Sequences for d1w1yb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1w1yb2 d.26.3.1 (B:292-379) Chitinase B {Serratia marcescens [TaxId: 615]} ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg nygyqrlwndktktpylyhaqnglfvty
Timeline for d1w1yb2: