Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins) |
Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species) |
Species Catalytic Fab 5C8 (mouse), kappa L chain [48863] (3 PDB entries) |
Domain d35c8h1: 35c8 H:1-113 [20297] Other proteins in same PDB: d35c8h2, d35c8l2 complexed with nox |
PDB Entry: 35c8 (more details), 2 Å
SCOP Domain Sequences for d35c8h1:
Sequence; same for both SEQRES and ATOM records: (download)
>d35c8h1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Catalytic Fab 5C8 (mouse), kappa L chain} evqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqkpeqglewiaqidpangntky dpkfqgkatitadtssntaylhlssltsedsavyycaadppyyghgdywgqgttltvss
Timeline for d35c8h1: