SCOPe 2.03: Domain d1w1vb1: 1w1v B:3-291,B:380-446

Lineage for d1w1vb1 (1w1v B:3-291,B:380-446)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.5: Type II chitinase [51534] (15 proteins)
   glycosylase family 18

6. Protein Chitinase B, catalytic domain [51546] (1 species)

7. Species Serratia marcescens [TaxId:615] [51547] (18 PDB entries)

8. Domain d1w1vb1: 1w1v B:3-291,B:380-446 [202969]
   Other proteins in same PDB: d1w1va2, d1w1va3, d1w1vb2, d1w1vb3
   automated match to d1o6ia2
   complexed with alj, gol, so4

Details for d1w1vb1

PDB Entry: 1w1v, 1.85 Å

PDB Description: crystal structure of s. marcescens chitinase b in complex with the cyclic dipeptide inhibitor cyclo-(l-arg-l-pro) at 1.85 a resolution

PDB Compounds: (B:) chitinase b

SCOPe Domain Sequences for d1w1vb1:

Sequence; same for both SEQRES and ATOM records:

>d1w1vb1 c.1.8.5 (B:3-291,B:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]}
trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrak
faqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfXddaesfkyka
kyikqqqlggvmfwhlgqdnrngdllaaldryfnaadyddsqldmgtglrytgvgpg

Timeline for d1w1vb1:

• d1w1vb1 is new in SCOPe 2.03-stable
  
• d1w1vb1 appears in SCOPe 2.04
  
• d1w1vb1 appears in the current release, SCOPe 2.08