Lineage for d1w1vb1 (1w1v B:3-291,B:380-446)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2831708Family c.1.8.5: Type II chitinase [51534] (15 proteins)
    glycosylase family 18
  6. 2831767Protein Chitinase B, catalytic domain [51546] (1 species)
  7. 2831768Species Serratia marcescens [TaxId:615] [51547] (18 PDB entries)
  8. 2831776Domain d1w1vb1: 1w1v B:3-291,B:380-446 [202969]
    Other proteins in same PDB: d1w1va2, d1w1va3, d1w1vb2, d1w1vb3
    automated match to d1o6ia2
    complexed with alj, gol, so4

Details for d1w1vb1

PDB Entry: 1w1v (more details), 1.85 Å

PDB Description: crystal structure of s. marcescens chitinase b in complex with the cyclic dipeptide inhibitor cyclo-(l-arg-l-pro) at 1.85 a resolution
PDB Compounds: (B:) chitinase b

SCOPe Domain Sequences for d1w1vb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1w1vb1 c.1.8.5 (B:3-291,B:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]}
trkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnlecaw
dpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasrak
faqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyqlt
iagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyna
lreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfXddaesfkyka
kyikqqqlggvmfwhlgqdnrngdllaaldryfnaadyddsqldmgtglrytgvgpg

SCOPe Domain Coordinates for d1w1vb1:

Click to download the PDB-style file with coordinates for d1w1vb1.
(The format of our PDB-style files is described here.)

Timeline for d1w1vb1: