Lineage for d35c8l1 (35c8 L:1-107)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 929301Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 930396Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
    VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 930882Species Mouse (Mus musculus), cluster 3.1 [TaxId:10090] [88527] (13 PDB entries)
  8. 930884Domain d35c8l1: 35c8 L:1-107 [20296]
    Other proteins in same PDB: d35c8h1, d35c8h2, d35c8l2
    part of catalytic Fab 5C8
    complexed with nox

Details for d35c8l1

PDB Entry: 35c8 (more details), 2 Å

PDB Description: catalytic antibody 5c8, fab-inhibitor complex
PDB Compounds: (L:) igg 5c8

SCOPe Domain Sequences for d35c8l1:

Sequence; same for both SEQRES and ATOM records: (download)

>d35c8l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 3.1 [TaxId: 10090]}
divltqspaimsaslgervtmtctasssvsssnlhwyqqkpgsspklwiystsnlasgvp
arfsgsgsgtsysltissmeaedaatyychqyhrspytfgggtkleik

SCOPe Domain Coordinates for d35c8l1:

Click to download the PDB-style file with coordinates for d35c8l1.
(The format of our PDB-style files is described here.)

Timeline for d35c8l1:

View in 3D
Domains from same chain:
(mouse over for more information)
d35c8l2