SCOPe 2.08: Domain d1w1pb1: 1w1p B:2-291,B:380-446

Lineage for d1w1pb1 (1w1p B:2-291,B:380-446)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.5: Type II chitinase [51534] (15 proteins)
   glycosylase family 18

6. Protein Chitinase B, catalytic domain [51546] (1 species)

7. Species Serratia marcescens [TaxId:615] [51547] (18 PDB entries)

8. Domain d1w1pb1: 1w1p B:2-291,B:380-446 [202957]
   Other proteins in same PDB: d1w1pa2, d1w1pa3, d1w1pb2, d1w1pb3
   automated match to d1o6ia2
   complexed with gio, gol, so4

Details for d1w1pb1

PDB Entry: 1w1p, 2.1 Å

PDB Description: crystal structure of s. marcescens chitinase b in complex with the cyclic dipeptide inhibitor cyclo-(gly-l-pro) at 2.1 a resolution

PDB Compounds: (B:) chitinase b

SCOPe Domain Sequences for d1w1pb1:

Sequence; same for both SEQRES and ATOM records:

>d1w1pb1 c.1.8.5 (B:2-291,B:380-446) Chitinase B, catalytic domain {Serratia marcescens [TaxId: 615]}
strkavigyyfiptnqinnytetdtsvvpfpvsnitpakakqlthinfsfldinsnleca
wdpatndakardvvnrltalkahnpslrimfsiggwyysndlgvshanyvnavktpasra
kfaqscvrimkdygfdgvdidweypqaaevdgfiaalqeirtllnqqtitdgrqalpyql
tiagaggafflsryysklaqivapldyinlmtydlagpwekvtnhqaalfgdaagptfyn
alreanlgwsweeltrafpspfsltvdaavqqhlmmegvpsakivmgvpfXddaesfkyk
akyikqqqlggvmfwhlgqdnrngdllaaldryfnaadyddsqldmgtglrytgvgpg

Timeline for d1w1pb1:

• d1w1pb1 first appeared in SCOPe 2.03
  
• d1w1pb1 appears in SCOPe 2.07