SCOPe 2.08: Domain d1w1pa2: 1w1p A:292-379

Lineage for d1w1pa2 (1w1p A:292-379)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Chitinase B [54560] (1 species)

7. Species Serratia marcescens [TaxId:615] [54561] (18 PDB entries)

8. Domain d1w1pa2: 1w1p A:292-379 [202955]
   Other proteins in same PDB: d1w1pa1, d1w1pa3, d1w1pb1, d1w1pb3
   automated match to d1o6ia3
   complexed with gio, gol, so4

Details for d1w1pa2

PDB Entry: 1w1p, 2.1 Å

PDB Description: crystal structure of s. marcescens chitinase b in complex with the cyclic dipeptide inhibitor cyclo-(gly-l-pro) at 2.1 a resolution

PDB Compounds: (A:) chitinase b

SCOPe Domain Sequences for d1w1pa2:

Sequence; same for both SEQRES and ATOM records:

>d1w1pa2 d.26.3.1 (A:292-379) Chitinase B {Serratia marcescens [TaxId: 615]}
ygrafkgvsggnggqysshstpgedpypstdywlvgceecvrdkdpriasyrqleqmlqg
nygyqrlwndktktpylyhaqnglfvty

Timeline for d1w1pa2:

• d1w1pa2 first appeared in SCOPe 2.03
  
• d1w1pa2 appears in SCOPe 2.07