Lineage for d1eo8h1 (1eo8 H:1-113)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 781544Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)
  6. 781740Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 782204Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (152 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E
    SQ NA # humanized antibody
    Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor
    Uniprot P01750 20-116 #
    HV06_MOUSE Ig heavy chain V region 102 precursor
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 782328Domain d1eo8h1: 1eo8 H:1-113 [20295]
    Other proteins in same PDB: d1eo8a_, d1eo8b_, d1eo8h2, d1eo8l1, d1eo8l2
    part of Influenza virus hemagglutinin-neutralizing Fab BH151
    complexed with man, nag

Details for d1eo8h1

PDB Entry: 1eo8 (more details), 2.8 Å

PDB Description: influenza virus hemagglutinin complexed with a neutralizing antibody
PDB Compounds: (H:) antibody (heavy chain)

SCOP Domain Sequences for d1eo8h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eo8h1 b.1.1.1 (H:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqlqqsgaelmkpgpsvkisckatgysfstyfiewirqrpghglewigeilpgsdntnf
nekfkdratftadtpsntaymqlssltsedsavyycarptgrlwfsywgqgtlvtvsa

SCOP Domain Coordinates for d1eo8h1:

Click to download the PDB-style file with coordinates for d1eo8h1.
(The format of our PDB-style files is described here.)

Timeline for d1eo8h1: