Lineage for d1eo8h1 (1eo8 H:1-113)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 157354Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 157410Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species)
  7. 158479Species Influenza virus hemagglutinin-neutralizing Fab BH151 (mouse), kappa L chain [48862] (1 PDB entry)
  8. 158480Domain d1eo8h1: 1eo8 H:1-113 [20295]
    Other proteins in same PDB: d1eo8a_, d1eo8b_, d1eo8h2, d1eo8l2

Details for d1eo8h1

PDB Entry: 1eo8 (more details), 2.8 Å

PDB Description: influenza virus hemagglutinin complexed with a neutralizing antibody

SCOP Domain Sequences for d1eo8h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eo8h1 b.1.1.1 (H:1-113) Immunoglobulin (variable domains of L and H chains) {Influenza virus hemagglutinin-neutralizing Fab BH151 (mouse), kappa L chain}
qvqlqqsgaelmkpgpsvkisckatgysfstyfiewirqrpghglewigeilpgsdntnf
nekfkdratftadtpsntaymqlssltsedsavyycarptgrlwfsywgqgtlvtvsa

SCOP Domain Coordinates for d1eo8h1:

Click to download the PDB-style file with coordinates for d1eo8h1.
(The format of our PDB-style files is described here.)

Timeline for d1eo8h1: